Iright
BRAND / VENDOR: Proteintech

Proteintech, G60291-1-5C, MultiPro® 5CFLX Anti-Human TNF Alpha (7B8A11)

CATALOG NUMBER: G60291-1-5C
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 10ug The TNF Alpha (G60291-1-5C) by Proteintech is a Monoclonal antibody targeting TNF Alpha in Single Cell (Intra) applications with reactivity to Human samples G60291-1-5C targets TNF Alpha in Single Cell (Intra) applications and shows reactivity with Human samples. Tested Applications Positive Single Cell (Intra) detected in: 10x Genomics Gene Expression Flex with Feature Barcodes and Multiplexing product. Recommended dilution SINGLE CELL (INTRA): <0.5ug/test Background Information TNF, as also known as TNF-alpha, or cachectin, is a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. It is expressed as a 26 kDa membrane bound protein and is then cleaved by TNF-alpha converting enzyme (TACE) to release the soluble 17 kDa monomer, which forms homotrimers in circulation. It is produced chiefly by activated macrophages, although it can be produced by many other cell types such as CD4+ lymphocytes, NK cells, neutrophils, mast cells, eosinophils, and neurons. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. This cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. This cytokine has been implicated in a variety of diseases, including autoimmune diseases, INS resistance, and cancer. Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG2b Class: Oligo Conjugate Type: Monoclonal Immunogen: CatNo: Ag11413 Product name: Recombinant human TNF-a protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-233 aa of BC028148 Sequence: MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL Predict reactive species Full Name: MultiPro® 5CFLX Anti-Human TNF Alpha (7B8A11) Calculated Molecular Weight: 233 aa, 26 kDa GenBank Accession Number: BC028148 Gene Symbol: TNF-alpha Gene ID (NCBI): 7124 ENSEMBL Gene ID: ENSG00000232810 RRID: AB_3673901 Conjugate: 5CFLX Full Oligo Sequence: CGGAGATGTGTATAAGAGACAGACACCGTATGATAGGCCCATATAAGAAA Barcode Sequence: ACACCGTATGATAGG Form: Liquid UNIPROT ID: P01375 Storage Buffer: PBS with 1mM EDTA and 0.09% sodium azide , pH 7.3. Storage Conditions: 2-8°C Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924