Iright
BRAND / VENDOR: Proteintech

Proteintech, G66321-1-5C, MultiPro® 5CFLX Anti-Human Fascin (1B5G3)

CATALOG NUMBER: G66321-1-5C
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 10ug The Fascin (G66321-1-5C) by Proteintech is a Monoclonal antibody targeting Fascin in Single Cell (Intra) applications with reactivity to Human samples G66321-1-5C targets Fascin in Single Cell (Intra) applications and shows reactivity with Human samples. Tested Applications Positive Single Cell (Intra) detected in: 10x Genomics Gene Expression Flex with Feature Barcodes and Multiplexing product. Recommended dilution SINGLE CELL (INTRA): <0.5ug/test Background Information Fascin is a highly conserved and ubiquitous actin cross-linking protein that has a major function in cell motility and adhesion. Fascin localizes to a number of highly dynamic cellular structures that require strong mechanical support which include stress fibers and cellular protrusions such as microvilli, microspikes and lamellipodia. Fascin is up-regulated in many human carcinomas. It's a marker for Reed-Sternberg cells in Hodgkin's disease; it is also a highly selective marker for dendritic cells of lymphoid tissues. Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG2a Class: Oligo Conjugate Type: Monoclonal Immunogen: CatNo: Ag6074 Product name: Recombinant human Fascin protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-187 aa of BC000521 Sequence: MTANGTAEAVQIQFGLINCGNKYLTAEAFGFKVNASASSLKKKQIWTLEQPPDEAGSAAVCLRSHLGRYLAADKDGNVTCEREVPGPDCRFLIVAHDDGRWSLQSEAHRRYFGGTEDRLSCFAQTVSPAEKWSVHIAMHPQVNIYSVTRKRYAHLSARPADEIAVDRDVPWGVDSLITLAFQDQRYS Predict reactive species Full Name: MultiPro® 5CFLX Anti-Human Fascin (1B5G3) Calculated Molecular Weight: 55 kDa GenBank Accession Number: BC000521 Gene Symbol: Fascin Gene ID (NCBI): 6624 ENSEMBL Gene ID: ENSG00000075618 RRID: AB_3673947 Conjugate: 5CFLX Full Oligo Sequence: CGGAGATGTGTATAAGAGACAGGCCGTTCGCGGTACGCCCATATAAGAAA Barcode Sequence: GCCGTTCGCGGTACG Form: Liquid UNIPROT ID: Q16658 Storage Buffer: PBS with 1mM EDTA and 0.09% sodium azide , pH 7.3. Storage Conditions: 2-8°C Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924