Iright
BRAND / VENDOR: Proteintech

Proteintech, G67244-1-5C, MultiPro® 5CFLX Anti-Human TPM4 (2E12D12)

CATALOG NUMBER: G67244-1-5C
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 10ug The TPM4 (G67244-1-5C) by Proteintech is a Monoclonal antibody targeting TPM4 in Single Cell (Intra) applications with reactivity to Human samples G67244-1-5C targets TPM4 in Single Cell (Intra) applications and shows reactivity with Human samples. Tested Applications Positive Single Cell (Intra) detected in: 10x Genomics Gene Expression Flex with Feature Barcodes and Multiplexing product. Recommended dilution SINGLE CELL (INTRA): <0.5ug/test Background Information TPM4 is a member of tropomyosins (TPMs), a multi-gene family of actin-binding proteins present in all eukaryotic cells. In muscle, TPMs are responsible for mediating contraction via regulation of the actin-myosin interaction. As to non-muscle cells, its proposed role is to stabilize the actin filaments by modulating the interaction with proteins that are responsible for the regulation of actin dynamics. The form of TPM4 in muscle has a higher molecular weight than the form found in non-muscle cells. Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG1 Class: Oligo Conjugate Type: Monoclonal Immunogen: CatNo: Ag6947 Product name: Recombinant human TPM4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-248 aa of BC037576 Sequence: MAGLNSLEAVKRKIQALQQQADEAEDRAQGLQRELDGERERREKAEGDVAALNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGELERAEERAEVSELKCGDLEEELKNVTNNLKSLEAASEKYSEKEDKYEEEIKLLSDKLKEAETRAEFAERTVAKLEKTIDDLEEKLAQAKEENVGLHQTLDQTLNELNCI Predict reactive species Full Name: MultiPro® 5CFLX Anti-Human TPM4 (2E12D12) Calculated Molecular Weight: 248 aa, 29 kDa GenBank Accession Number: BC037576 Gene Symbol: TPM4 Gene ID (NCBI): 7171 ENSEMBL Gene ID: ENSG00000167460 RRID: AB_3673963 Conjugate: 5CFLX Full Oligo Sequence: CGGAGATGTGTATAAGAGACAGTCACCGCATATATACCCCATATAAGAAA Barcode Sequence: TCACCGCATATATAC Form: Liquid UNIPROT ID: P67936 Storage Buffer: PBS with 1mM EDTA and 0.09% sodium azide , pH 7.3. Storage Conditions: 2-8°C Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924