Proteintech, G68080-1-5C, MultiPro® 5CFLX Anti-Human LASP1 (1G4B6)

Size: 10ug The LASP1 (G68080-1-5C) by Proteintech is a Monoclonal antibody targeting LASP1 in Single Cell (Intra) applications with reactivity to Human samples G68080-1-5C targets LASP1 in Single Cell (Intra) applications and shows reactivity with Human samples. Tested Applications Positive Single Cell (Intra) detected in: 10x Genomics Gene Expression Flex with Feature Barcodes and Multiplexing product. Recommended dilution SINGLE CELL (INTRA): <0.5ug/test Background Information LASP1(LIM and SH3 protein 1), also known as MLN50, is a 261 amino acid protein that localizes to both the cytoplasm and the cytoskeleton(PMID: 7589475). LASP1 consists of an N-terminal LIM-domain with two zinc finger motifs, followed by two central actin-binding nebulin repeats, flanked by a linker region and a C-terminal SH3 domain (PMID: 17177073, 9848085). LASP-1 interacts with F-Actin and plays an important role in the regulation of Actin-associated cytoskeletal organization. Agonist-dependent changes in LASP1 phosphorylation may regulate Actin-related ion transport activities in epithelial cells (PMID: 15465019,12571245). Overexpression of LASP-1 is associated with breast cancer, and plays a role in tumor transformation and metastasis (PMID: 17956604). Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG1 Class: Oligo Conjugate Type: Monoclonal Immunogen: CatNo: Ag18101 Product name: Recombinant human LASP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 125-210 aa of BC012460 Sequence: EFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGKRYRAA Predict reactive species Full Name: MultiPro® 5CFLX Anti-Human LASP1 (1G4B6) Calculated Molecular Weight: 30 kDa GenBank Accession Number: BC012460 Gene Symbol: LASP1 Gene ID (NCBI): 3927 ENSEMBL Gene ID: ENSG00000002834 RRID: AB_3673971 Conjugate: 5CFLX Full Oligo Sequence: CGGAGATGTGTATAAGAGACAGACAATACACCAGCACCCCATATAAGAAA Barcode Sequence: ACAATACACCAGCAC Form: Liquid UNIPROT ID: Q14847 Storage Buffer: PBS with 1mM EDTA and 0.09% sodium azide , pH 7.3. Storage Conditions: 2-8°C Stable for one year after shipment.