Proteintech, PE-FcA98155, FcZero-rAb™ PE Anti-Mouse CD200R1 Rabbit Recombinant Antibody

Size: 100ug The CD200R1 (PE-FcA98155) by Proteintech is a Recombinant antibody targeting CD200R1 in FC applications with reactivity to mouse samples PE-FcA98155 targets CD200R1 in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: MC/9 cells Recommended dilution Flow Cytometry (FC): FC : 0.1 ug per 10^6 cells in a 100 µl suspension Background Information Cell surface glycoprotein CD200 receptor 1 (CD200R1) is also called CD200R, CRTR2, MOX2R, and OX2R, and belongs to the CD200R family. CD200R1 is an inhibitory receptor for the CD200/OX2 cell surface glycoprotein. CD200R1 is highly glycosylated, containing ten potential N-glycosylation sites (PMID: 15187158). CD200R1 limits inflammation by inhibiting the expression of pro-inflammatory molecules including TNF-alpha, interferons, and inducible nitric oxide synthase (iNOS) in response to selected stimuli. As an immune inhibitory molecule, CD200R1 binds to CD200, ultimately leading to the inhibition of classical activation of macrophages and microglia (PMID: 24588829). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0988 Product name: Recombinant Mouse CD200R1 protein (His tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 26-238 aa of NM_021325.3 Sequence: TDKNQTTQNNSSSPLTQVNTTVSVQIGTKALLCCFSIPLTKAVLITWIIKLRGLPSCTIAYKVDTKTNETSCLGRNITWASTPDHSPELQISAVTLQHEGTYTCETVTPEGNFEKNYDLQVLVPPEVTYFPEKNRSAVCEAMAGKPAAQISWSPDGDCVTTSESHSNGTVTVRSTCHWEQNNVSDVSCIVSHLTGNQSLSIELSRGGNQSLRP Predict reactive species Full Name: CD200 receptor 1 Calculated Molecular Weight: 36 kDa GenBank Accession Number: NM_021325.3 Gene Symbol: Cd200r1 Gene ID (NCBI): 57781 Conjugate: PE Fluorescent Dye Excitation/Emission Maxima Wavelengths: 496 nm, 565 nm / 578 nm Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9ES57 Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.