Proteintech, PE-FcA98273, FcZero-rAb™ PE Anti-Human DR5/CD262 Rabbit Recombinant Antibody

Size: 100tests The DR5/CD262 (PE-FcA98273) by Proteintech is a Recombinant antibody targeting DR5/CD262 in FC applications with reactivity to human samples PE-FcA98273 targets DR5/CD262 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: human PBMCs Recommended dilution Flow Cytometry (FC): FC : 5 ul per 10^6 cells in a 100 µl suspension Background Information DR5, also known as CD262, TNFRSF10B, TRAILR2, TRICK2 and KILLER, is a widely expressed single-pass type I membrane protein belonging to the tumour necrosis factor receptor superfamily (TNFRSF). It is a receptor for TNF-related apoptosis-inducing ligand (TRAIL), which is a member of the tumor necrosis factor (TNF) family of cytokines and induces apoptosis in a wide variety of cells (PMID: 9311998). DR5 contains two extracellular cysteine-rich repeats, typical for TNF receptor (TNFR) family members, and a cytoplasmic death domain (DD), through which DR5 is capable to transmit the apoptotic signal (PMID: 9311998; 20531300). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1648 Product name: Recombinant Human DR5 protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 56-182 aa of BC001281 Sequence: ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE Predict reactive species Full Name: tumor necrosis factor receptor superfamily, member 10b Calculated Molecular Weight: 48 kDa GenBank Accession Number: BC001281 Gene Symbol: DR5 Gene ID (NCBI): 8795 Conjugate: PE Fluorescent Dye Excitation/Emission Maxima Wavelengths: 496 nm, 565 nm / 578 nm Form: Liquid Purification Method: Protein A purification UNIPROT ID: O14763 Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.