Iright
BRAND / VENDOR: New England Biolabs

New England Biolabs, P6043S, Rapid PNGase F Antibody Standard

CATALOG NUMBER: P6043S
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Rapid PNGase F Antibody Standard is a murine anti-MBP monoclonal antibody, isotype IgG2a. This antibody standard can be used as a positive control for Rapid PNGase F. Related Categories Glycoprotein Substrates Applications Glycan Sequencing,, Recombinant Glycoprotein Expression,, Glycoprotein Analysis Specification Isotype Mouse Isotype IgG2a Source Species murine FAQ Q: Is the Rapid PNGase F Antibody Standard a monoclonal antibody? What cell type is used for production? A: Yes, the Rapid PNGase F Antibody Standard is a monoclonal antibody. It is a murine anti-maltose binding protein antibody, isotype IgG2a. Q: What isotype of IgG is the Rapid PNGase F Antibody Standard? A: IgG2a Q: Is the Rapid PNGase F Antibody Standard glycosylated? If so, in what region? A: Yes, the Rapid PNGase F Antibody Standard contains typical IgG glycosylation in a conserved Asn (#295) of the Fc region. There are no other glycosylation sites. Q: Is the Rapid PNGase F Antibody Standard tagged? A: No, Rapid PNGase F Antibody Standard is not tagged. Q: What is the amino acid sequence of the Rapid PNGase F Antibody Standard? Where is the glycosylation site? A: The Rapid PNGase F Antibody Standard has 2 light chains (LC) and 2 heavy chains (HC).The glycosylation site is on the heavy chain at amino acid 295 (indicated in red in the sequence). Light Chain Sequence: MDIVMTQSPSSLAMSVGQKVTMSCKSSQSLLINNNQKNYLAWYQQKPGQSPKLLVYFAST RESGVPDRFIGSGSGTDFTLTISSVQAEDLADYFCQQHFTAPYTFGGGTKLEIKRADAAP TVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTY SMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC Heavy Chain Sequence: MQVQLQQPGSELVRPGASVKLSCKASGYTFTNSWMHWVKQRPGQGLEWIGNIFPGNGNTN YDENFKSKATLTVDTSSNTAYMQLSSLTSEDSAVYYCTRGLFAYWGQGTLVTVSAAKTTA PSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLS SSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRVPTIKPCPPCKCPAPNLLGGPSVFI FPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRV VSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQ VTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNS YSCSVVHEGLHNHHTTKSFSRTPGK Q: What are the typical N-glycans found on the Rapid PNGase F Antibody Standard? A: The Rapid PNGase F Antibody Standard contains typical IgG glycosylation with mostly GF0, G1F, G2F, as well as some sialylated (mostly NGNA) species. There are also traces of non-fucosylated glycans, high mannose glycans, and hybrid glycans. There is evidence of a1,3-Gal structures.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924