Proteintech, 10082-2-AP, MATK Polyclonal antibody

Size: 20ul / 150ul The MATK (10082-2-AP) by Proteintech is a Polyclonal antibody targeting MATK in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 10082-2-AP targets MATK in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: K-562 cells, mouse thymus tissue Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information MATK(Megakaryocyte-associated tyrosine-protein kinase) is also named as CTK, HYL and belongs to the protein kinase superfamily. This protein can can inhibit the kinase activity of certain Src kinase family members by phosphorylating the C-terminal tyrosine and by a non-catalytic mechanism. It may play an inhibitory role in the control of T-cell proliferation. MATK has 3 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0128 Product name: Recombinant human MATK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 118-402 aa of BC000114 Sequence: SLMPWFHGKISGQEAVQQLQPPEDGLFLVRESARHPGDYVLCVSFGRDVIHYRVLHRDGHLTIDEAVFFCNLMDMVEHYSKDKGAICTKLVRPKRKHGTKSAEEELARAGWLLNLQHLTLGAQIGEGEFGAVLQGEYLGQKVAVKNIKCDVTAQAFLDETAVMTKMQHENLVRLLGVILHQGLYIVMEHVSKGNLVNFLRTRGRALVNTAQLLQFSLHVAEGMEYLESKKLVHRDLAARNILVSEDLVAKVSDFGLAKAERKGLDSSRLPVKWTAPEALKHGKFT Predict reactive species Full Name: megakaryocyte-associated tyrosine kinase Calculated Molecular Weight: 56 kDa Observed Molecular Weight: 56 kDa GenBank Accession Number: BC000114 Gene Symbol: MATK Gene ID (NCBI): 4145 RRID: AB_2141386 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P42679 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.