Proteintech, 10089-2-AP, COPS8/COP9 Polyclonal antibody

Size: 20ul / 150ul The COPS8/COP9 (10089-2-AP) by Proteintech is a Polyclonal antibody targeting COPS8/COP9 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 10089-2-AP targets COPS8/COP9 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, SH-SY5Y cells, PC-12 cells, mouse brain tissue, rat brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human colon cancer tissue, mouse brain tissue, human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information COPS8 is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0143 Product name: Recombinant human COPS8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 14-194 aa of BC003090 Sequence: KKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNE Predict reactive species Full Name: COP9 constitutive photomorphogenic homolog subunit 8 (Arabidopsis) Calculated Molecular Weight: 23 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: BC003090 Gene Symbol: COPS8 Gene ID (NCBI): 10920 RRID: AB_2081903 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99627 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.