Proteintech, 10092-1-AP, KCNS3 Polyclonal antibody

Size: 20ul / 150ul The KCNS3 (10092-1-AP) by Proteintech is a Polyclonal antibody targeting KCNS3 in WB, ELISA applications with reactivity to human samples 10092-1-AP targets KCNS3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, human placenta tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information KCNS3, also name as Kv9.3, belongs to S subfamily of potassium voltage-gated channel. It is highly expressed in pulmonary artery myocytes, placenta, and parvalbumin-containing GABA neurons in brain cortex.Its main functions are associated with the regulation of the resting membrane potential and the control of the shape and frequency of action potentials. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0137 Product name: Recombinant human KCNS3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 7-298 aa of BC004148 Sequence: FHRPGQDEELVNLNVGGFKQSVDQSTLLRFPHTRLGKLLTCHSEEAILELCDDYSVADKEYYFDRNPSLFRYVLNFYYTGKLHVMEELCVFSFCQEIEYWGINELFIDSCCSNRYQERKEENHEKDWDQKSHDVSTDSSFEESSLFEKELEKFDTLRFGQLRKKIWIRMENPAYCLSAKLIAISSLSVVLASIVAMCVHSMSEFQNEDGEVDDPVLEGLEIACIAWFTGELAVRLAAAPCQKKFWKNPLNIIDFVSIIPFYATLAVDTKEEESEDIENMGKVVQILRLMRIF Predict reactive species Full Name: potassium voltage-gated channel, delayed-rectifier, subfamily S, member 3 Calculated Molecular Weight: 59 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC004148 Gene Symbol: KCNS3 Gene ID (NCBI): 3790 RRID: AB_3085364 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BQ31 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.