Proteintech, 10093-2-AP, GTF2F1 Polyclonal antibody

Size: 20ul / 150ul The GTF2F1 (10093-2-AP) by Proteintech is a Polyclonal antibody targeting GTF2F1 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 10093-2-AP targets GTF2F1 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: K-562 cells Positive IP detected in: K-562 cells Positive IHC detected in: mouse lung tissue, rat ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information In eukaryotic systems, the initiation of gene transcription involves the ordered assembly of a multiprotein complex on proximal promoter elements, consisting of RNA polymerase II and broad families of auxiliary transcription factors. Such factors can be divided into two major functional classes: the basal factors that are required for transcription of all Pol II genes, including TFIIA, B, D, E, F and H; and sequence specific factors that regulate gene expression. The basal transcription factors and Pol II form a specific multiprotein complex near the transcription start site by interacting with core promotor elements such as the TATA box generally located 25-30 base pairs upstream of the transcription start site. TFIIF, a heteromer composed of a small (RAP 30) and a large (RAP 74) subunit, acting at an intermediate stage in initiation complex formation, binds directly to RNA polymerase II in solution and decrease the affinity of RNA polymerase II for nonspecific DNA. In addition, TFIIF stimulates transcription elongation by RNA polymerase II. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0133 Product name: Recombinant human GTF2F1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 10-215 aa of BC000120 Sequence: NVTEYVVRVPKNTTKKYNIMAFNAADKVNFATWNQARLERDLSNKKIYQEEEMPESGAGSEFNRKLREEARRKKYGIVLKEFRPEDQPWLLRVNGKSGRKFKGIKKGGVTENTSYYIFTQCPDGAFEAFPVHNWYNFTPLARHRTLTAEEAEEEWERRNKVLNHFSIMQQRRLKDQDQDEDEEEKEKRGRRKASELRIHDLEDDLE Predict reactive species Full Name: general transcription factor IIF, polypeptide 1, 74kDa Calculated Molecular Weight: 58 kDa Observed Molecular Weight: 74 kDa GenBank Accession Number: BC000120 Gene Symbol: GTF2F1 Gene ID (NCBI): 2962 RRID: AB_2114542 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P35269 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.