Iright
BRAND / VENDOR: Proteintech

Proteintech, 10103-1-AP, AKAP8L Polyclonal antibody

CATALOG NUMBER: 10103-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The AKAP8L (10103-1-AP) by Proteintech is a Polyclonal antibody targeting AKAP8L in WB, IF/ICC, ELISA applications with reactivity to human samples 10103-1-AP targets AKAP8L in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: PC-3 cells Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information AKAP8L, also named as NAKAP, or NAKAP95, is a 646 amino acid protein, which contains two C2H2 AKAP95-type zinc fingers and belongs to the AKAP95 family. AKAP8L localizes in the nucleus matrix and is expressed in the brain cortex. AKAP8L could play a role in constitutive transport element (CTE)-mediated gene expression. AKAP8L may be involved in nuclear envelope breakdown and chromatin condensation. It also may regulate the initiation phase of DNA replication when associated with TMPO-beta. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0145 Product name: Recombinant human AKAP8L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 67-286 aa of BC000713 Sequence: HSWEMPSSDTNANTSASGSASADSVLSRINQRLDMVPHLETDMMQGGVYGSGGERYDSYESCDSRAVLSERDLYRSGYDYSELDPEMEMAYEGQYDAYRDQFRMRGNDTFGPRAQGWARDARSGRPMASGYGRMWEDPMGARGQCMSGASRLPSLFSQNIIPEYGMFQGMRGGGAFPGGSRFGFGFGNGMKQMRRTWKTWTTADFRTKKKKRKQGGSPDE Predict reactive species Full Name: A kinase (PRKA) anchor protein 8-like Calculated Molecular Weight: 72 kDa Observed Molecular Weight: 72 kDa GenBank Accession Number: BC000713 Gene Symbol: AKAP8L Gene ID (NCBI): 26993 RRID: AB_2258197 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9ULX6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924