Iright
BRAND / VENDOR: Proteintech

Proteintech, 10121-2-AP, ICAM2/CD102 Polyclonal antibody

CATALOG NUMBER: 10121-2-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ICAM2/CD102 (10121-2-AP) by Proteintech is a Polyclonal antibody targeting ICAM2/CD102 in WB, IHC, ELISA applications with reactivity to human, mouse samples 10121-2-AP targets ICAM2/CD102 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, HEK-293 cells, mouse brain tissue, RAW 264.7 cells Positive IHC detected in: human breast cancer tissue, mouse spleen tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ICAM2 is a cell adhesion protein having important roles in cell migration, especially during inflammation when leukocytes cross the endothelium. Initially described as a receptor for lymphocyte function-associated antigen-1 (LFA1), ICAM2 may play a role in lymphocyte recirculation by blocking LFA-1-dependent cell adhesion. It mediates adhesive interactions important for antigen-specific immune response, NK-cell mediated clearance, lymphocyte recirculation, and other cellular interactions important for immune response and surveillance. ICAM2 has six N-linked glycosylation sites at amino acids (asparagines) 47, 82, 105, 153, 178 and 187. This antibody got 55-80 kDa in western blotting maybe due to glycosylation. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0165 Product name: Recombinant human ICAM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 104-275 aa of BC003097 Sequence: SNVSVYQPPRQVILTLQPTLVAVGKSFTIECRVPTVEPLDSLTLFLFRGNETLHYETFGKAAPAPQEATATFNSTADREDGHRNFSCLAVLDLMSRGGNIFHKHSAPKMLEIYEPVSDSQMVIIVTVVSVLLSLFVTSVLLCFIFGQHLRQQRMGTYGVRAAWRRLPQAFRP Predict reactive species Full Name: intercellular adhesion molecule 2 Calculated Molecular Weight: 31 kDa Observed Molecular Weight: 55-80 kDa GenBank Accession Number: BC003097 Gene Symbol: ICAM2/CD102 Gene ID (NCBI): 3384 RRID: AB_2233415 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P13598 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924