Proteintech, 10125-2-AP, KIFC3 Polyclonal antibody

Size: 20ul / 150ul The KIFC3 (10125-2-AP) by Proteintech is a Polyclonal antibody targeting KIFC3 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples 10125-2-AP targets KIFC3 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse lung tissue, mouse kidney tissue Positive IP detected in: mouse kidney tissue Positive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0172 Product name: Recombinant human KIFC3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 73-314 aa of BC001211 Sequence: ARSAARPALAQCRALSVDWAGPGSPHGLYLTLQVEHLKEKLISQAQEVSRLRSELGGTDLEKHRDLLMVENERLRQEMRRCEAELQELRTKPAGPCPGCEHSQESAQLRDKLSQLQLEMAESKGMLSELNLEVQQKTDRLAEVELRLKDCLAEKAQEEERLSRRLRDSHETIASLRAQSPPVKYVIKTVEVESSKTKQALSESQARNQHLQEQVAMQRQVLKEMEQQLQSSHQLTARLRAQI Predict reactive species Full Name: kinesin family member C3 Calculated Molecular Weight: 78 kDa Observed Molecular Weight: 80-85 kDa, 95-100 kDa GenBank Accession Number: BC001211 Gene Symbol: KIFC3 Gene ID (NCBI): 3801 RRID: AB_2296476 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BVG8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.