Proteintech, 10129-2-AP, NFYC Polyclonal antibody

Size: 20ul / 150ul The NFYC (10129-2-AP) by Proteintech is a Polyclonal antibody targeting NFYC in WB, ELISA applications with reactivity to human samples 10129-2-AP targets NFYC in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information NFYC, also named as Nuclear transcription factor Y subunit gamma or Transactivator HSM-1/2, is a 458 amino acid protein, which belongs to the NFYC/HAP5 subunit family. NFYC localizes in the nucleus and stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters, for example in type 1 collagen, albumin and beta-actin genes. SP1, NFYC and FOXO3, FOXO4 transcription factors are involved in the regulation of STK11 transcription. Specification Tested Reactivity: human Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0140 Product name: Recombinant human NFYC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-251 aa of BC005003 Sequence: MSTEGGFGGTSSSDAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPRDELKPPKRQEEVRQSVTPAEPVQYYFTLAQQPTAVQVQGQQQGQQTTSSTTTIQPGQIIIAQPQQGQTTPVTMQVGEGQQVQIVQAQPQGQAQQAQSGTGQTMQVMQQIITNTGEIQQIPVQLNAGQLQYI Predict reactive species Full Name: nuclear transcription factor Y, gamma Calculated Molecular Weight: 37 kDa, 50 kDa Observed Molecular Weight: 48 kDa GenBank Accession Number: BC005003 Gene Symbol: NFYC Gene ID (NCBI): 4802 RRID: AB_2152244 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13952 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.