Proteintech, 10134-1-AP, LSM8 Polyclonal antibody

Size: 20ul / 150ul The LSM8 (10134-1-AP) by Proteintech is a Polyclonal antibody targeting LSM8 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 10134-1-AP targets LSM8 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HL-60 cells Positive IHC detected in: human kidney tissue, mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:750-1:3000 Background Information Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing[PMID:15075370]. Lsm2-Lsm8 (Lsm stands for Like Sm), binds and stabilizes the 3′ end of the spliceosomal U6 snRNA Lsm proteins facilitate the annealing of U6 snRNA with U4 snRNA in vitro and interact with the U4/U6 annealing factor Prp24, suggesting that Lsm proteins function in U4/U6 snRNP formation in vivo [PMID:15485930, 17251193]. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0178 Product name: Recombinant human LSM8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-96 aa of BC002742 Sequence: MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLYIVRGDNVAVIGEIDEETDSALDLGNIRAEPLNSVAH Predict reactive species Full Name: LSM8 homolog, U6 small nuclear RNA associated (S. cerevisiae) Calculated Molecular Weight: 14 kDa /75 kDa Observed Molecular Weight: 11 kDa GenBank Accession Number: BC002742 Gene Symbol: LSM8 Gene ID (NCBI): 51691 RRID: AB_513438 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95777 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.