Proteintech, 10135-1-AP, VAMP2 Polyclonal antibody

Size: 20ul / 150ul The VAMP2 (10135-1-AP) by Proteintech is a Polyclonal antibody targeting VAMP2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 10135-1-AP targets VAMP2 in WB, IHC, IF, ELISA, Blocking applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, fetal human brain tissue, rat brain tissue Positive IHC detected in: mouse brain tissue, human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information VAMP2 (vesicle-associated membrane protein 2), also named as synaptobrevin 2, is a member of the SNARE (soluble NSF-attachment protein receptor) family proteins. Characterized by a common sequence called the SNARE motif, SNARE proteins are involved in membrane fusion and vesicular transport (PMID: 11252968). VAMP2, with a molecular mass of 15-19 kDa, consists of a short N-terminal sequence, a SNARE motif, and a C-terminal transmembrane region. It is required for fast calcium-triggered synaptic vesicle fusion. VAMP2 forms a stable complex with STX1 (syntaxin 1) and SNAP25 (synaptosomal-associated protein 25) during synaptic vesicle fusion (PMID: 16793874). It also forms a distinct complex with synaptophysin. VAMP2 is expressed in nervous system and some non-neuronal tissues, such as skeletal muscle (PMID: 18570252). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0179 Product name: Recombinant human VAMP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-116 aa of BC002737 Sequence: MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST Predict reactive species Full Name: vesicle-associated membrane protein 2 (synaptobrevin 2) Calculated Molecular Weight: 13 kDa Observed Molecular Weight: 19 kDa GenBank Accession Number: BC002737 Gene Symbol: VAMP2 Gene ID (NCBI): 6844 RRID: AB_2256918 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P63027 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.