Proteintech, 10140-2-AP, PPP1CB Polyclonal antibody

Size: 20ul / 150ul The PPP1CB (10140-2-AP) by Proteintech is a Polyclonal antibody targeting PPP1CB in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 10140-2-AP targets PPP1CB in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human brain tissue, NIH/3T3 Positive IP detected in: mouse brain tissue Positive IHC detected in: human cervical cancer tissue, human ovary tumor tissue, mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information Protein phosphatase 1 (PP1) is the main eukaryotic protein serine/threonine phosphatase that regulates an enormous variety of cellular processes including protein-protein interactions, gene transcription, cell-cycle progression and apoptosis. It is a trimeric complex composed of a regulatory subunit, a variable subunit and a catalytic subunit. The catalytic subunit of PP1 (PP1c) can interact with amount of regulatory subunits in vivo that target it to particular subcellular locations and regulate its activity towards specific substrates. PPP1CB migrated as a 37kd protein on SDS page. This antibody is specific to PPP1CB. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0183 Product name: Recombinant human PPP1CB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-183 aa of BC002697 Sequence: MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSME Predict reactive species Full Name: protein phosphatase 1, catalytic subunit, beta isoform Calculated Molecular Weight: 37 kDa Observed Molecular Weight: 37 kDa GenBank Accession Number: BC002697 Gene Symbol: PPP1CB Gene ID (NCBI): 5500 RRID: AB_2168272 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P62140 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.