Proteintech, 10154-2-AP, Annexin A7 Polyclonal antibody

Size: 20ul / 150ul The Annexin A7 (10154-2-AP) by Proteintech is a Polyclonal antibody targeting Annexin A7 in WB, IHC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 10154-2-AP targets Annexin A7 in WB, IHC, IF, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, Jurkat cells, mouse lung tissue, L02 cells, mouse brain tissue, mouse heart tissue, HeLa cells, RAW 264.7 cells, rat brain tissue Positive IP detected in: U-87 MG cells, mouse heart tissue Positive IHC detected in: mouse heart tissue, human pancreas tissue, human prostate cancer tissue, human stomach tissue, human stomach cancer tissue, mouse stomach tissue, rat stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Annexin A7 (Anx7) belongs to a ubiquitous and relatively abundant family of Ca2+-dependent membrane-binding proteins, which are thought to be involved in multiple aspects of cell biology including membrane trafficking, mediation of cell-matrix interactions and membrane organization within cells. Anx7, migrated as a 50 kDa protein in SDS-PAGE, has been proposed to function in the fusion of vesicles, acting as a Ca++ channel and as Ca++ -activated GTPase, thus inducing Ca++ /GTP-dependent secretory events. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0206 Product name: Recombinant human ANXA7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 236-466 aa of BC002632 Sequence: PTYYDAWSLRKAMQGAGTQERVLIEILCTRTNQEIREIVRCYQSEFGRDLEKDIRSDTSGHFERLLVSMCQGNRDENQSINHQMAQEDAQRLYQAGEGRLGTDESCFNMILATRSFPQLRATMEAYSRMANRDLLSSVSREFSGYVESGLKTILQCALNRPAFFAERLYYAMKGAGTDDSTLVRIVVTRSEIDLVQIKQMFAQMYQKTLGTMIAGDTSGDYRRLLLAIVGQ Predict reactive species Full Name: annexin A7 Calculated Molecular Weight: 50 kDa Observed Molecular Weight: 47 kDa, 51 kDa GenBank Accession Number: BC002632 Gene Symbol: Annexin A7 Gene ID (NCBI): 310 RRID: AB_2227386 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P20073 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.