Proteintech, 10155-1-AP, CDC42 Polyclonal antibody

Size: 20ul / 150ul The CDC42 (10155-1-AP) by Proteintech is a Polyclonal antibody targeting CDC42 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 10155-1-AP targets CDC42 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HT-29 cells, C6 cells, HeLa cells, Jurkat cells, NIH/3T3 cells, mouse brain tissue Positive IHC detected in: human pancreas cancer tissue, human pancreas tissue, human skeletal muscle tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Cdc42, the human homologue of the cell division cycle 42 of Saccharomyces cerevisiae, belongs to the Rho/Rac subfamily of Ras-like GTPases. It acts as molecular switches to regulate numerous cellular responses including the organization of the actin cytoskeleton, gene transcription, cell cycle progression, and membrane trafficking. The molecular weight is about 21 kd. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, chicken, bovine, hamster Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0207 Product name: Recombinant human CDC42 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-186 aa of BC002711 Sequence: MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSR Predict reactive species Full Name: cell division cycle 42 (GTP binding protein, 25kDa) Calculated Molecular Weight: 21 kDa Observed Molecular Weight: 21 kDa GenBank Accession Number: BC002711 Gene Symbol: CDC42 Gene ID (NCBI): 998 RRID: AB_2078096 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P60953 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.