Proteintech, 10161-1-AP, TAP2 Polyclonal antibody

Size: 20ul / 150ul The TAP2 (10161-1-AP) by Proteintech is a Polyclonal antibody targeting TAP2 in WB, IHC, ELISA applications with reactivity to human samples 10161-1-AP targets TAP2 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, SH-SY5Y cells Positive IHC detected in: human intrahepatic cholangiocarcinoma tissue, human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information TAP2, also known as APT2, ABCB3, is a member of the superfamily of ATP-binding cassette (ABC) transporters. TAP2 mediates unidirectional translocation of peptide antigens from cytosol to endoplasmic reticulum (ER) for loading onto MHC class I (MHCI) molecules (PMID: 25656091). Mutations in TAP2 may be associated with Bare lymphocyte syndrome 1 (BLS1) and schizophrenia(PMID: 7517574, 24365204). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0190 Product name: Recombinant human TAP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-223 aa of BC002751 Sequence: MRLPDLRPWTSLLLVDAALLWLLQGPLGTLLPQGLPGLWLEGTLRLGGLWGLLKLRGLLGFVGTLLLPLCLATPLTVSLRALVAGASRAPPARVASAPWSWLLVGYGAAGLSWSLWAVLSPPGAQEKEQDQVNNKVLMWRLLKLSRPDLPLLVAAFFFLVLAVLGETLIPHYSGRVIDILGGDFDPHAFASAIFFMCLFSFGSSLSAGCRGGCFTYTMSRINL Predict reactive species Full Name: transporter 2, ATP-binding cassette, sub-family B (MDR/TAP) Calculated Molecular Weight: 76 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC002751 Gene Symbol: TAP2 Gene ID (NCBI): 6891 RRID: AB_3085365 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q03519 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.