Proteintech, 10168-2-AP, ACSM3 Polyclonal antibody

Size: 20ul / 150ul The ACSM3 (10168-2-AP) by Proteintech is a Polyclonal antibody targeting ACSM3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 10168-2-AP targets ACSM3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse kidney tissue, HEK-293 cells, rat kidney tissue Positive IHC detected in: human colon cancer tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information SA hypertension-associated rat homolog (SAH, synonym: SA) is expressed at 10-fold greater levels in the kidney of the spontaneously hypertensive rat than in the corresponding wild-type strain. The gene is linked to blood pressure levels in a number of crosses involving the spontaneously hypertensive rat and other strains of genetically hypertensive rats. Human SAH gene polymorphism may be associated with the renal prognosis of immunoglobulin A nephropathy through its effect on blood pressure. Furthermore, variation in SAH has a role in predisposition. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0224 Product name: Recombinant human ACSM3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-320 aa of BC002790 Sequence: MLARVTRKMLRHAKCFQRLAIFGSVRALHKDNRTATPQNFSNYESMKQDFKLGIPEYFNFAKDVLDQWTDKEKAGKKPSNPAFWWINRNGEEMRWSFEELGSLSRKFANILSEACSLQRGDRVILILPRVPEWWLANVACLRTGTVLIPGTTQLTQKDILYRLQSSKANCIITNDVLAPAVDAVASKCENLHSKLIVSENSREGWGNLKELMKHASDSHTCVKTKHNEIMAIFFTSGTSGYPKMTAHTHSSFGLGLSVNGRFWLDLTPSDVMWNTSDTGWAKSAWSSVFSPWIQGACVFTHHLPRFEPTSILQTLSKYPI Predict reactive species Full Name: acyl-CoA synthetase medium-chain family member 3 Calculated Molecular Weight: 49 kDa, 66 kDa Observed Molecular Weight: 60-70 kDa GenBank Accession Number: BC002790 Gene Symbol: ACSM3 Gene ID (NCBI): 6296 RRID: AB_2222699 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q53FZ2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.