Proteintech, 10178-1-AP, Placental lactogen Polyclonal antibody

Size: 20ul / 150ul The Placental lactogen (10178-1-AP) by Proteintech is a Polyclonal antibody targeting Placental lactogen in WB, IHC, ELISA applications with reactivity to human samples 10178-1-AP targets Placental lactogen in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human placenta tissue Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Chorionic somatomammotropin hormone 1 (placental lactogen, CSH1), is a hormone with the molecular weight of 25 kDa. The data suggest that this protein may link with the Silver-Russell syndrome (SRS), a disease of pre- and postnatal growth restriction and a characteristic small, triangular face. SRS is also accompanied by other dysmorphic features including fifth finger clinodactyly and skeletal asymmetry. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0201 Product name: Recombinant human CSH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 6-207 aa of BC002717 Sequence: RTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQ Predict reactive species Full Name: chorionic somatomammotropin hormone 1 (placental lactogen) Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 22-25 kDa GenBank Accession Number: BC002717 Gene Symbol: CSH1 Gene ID (NCBI): 1442 RRID: AB_2083884 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P0DML2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.