Proteintech, 10189-2-AP, IGFBP3 Polyclonal antibody

Size: 20ul / 150ul The IGFBP3 (10189-2-AP) by Proteintech is a Polyclonal antibody targeting IGFBP3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 10189-2-AP targets IGFBP3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells, SKOV-3 cells Positive IHC detected in: human breast cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Insulin-like growth factor binding protein-3 (IGFBP-3) contains a 27 amino acid putative signal sequence followed by a mature protein of 264 amino acids with 18 cysteine residues clustered near the N- and C-terminus. Accordingly, expression of the cloned IGFBP-3 cDNA in mammalian tissue culture cells results in secretion of the protein into the culture medium. IGFBP-3 shares high homology (33% amino acid identity) including conservation of all 18 cysteine residues with a smaller human IGF-binding protein (BP-28) identified in amniotic fluid. IGFBP-3 has one or more glycosylation sites with a protein core of ∼30 kDa. Western blots revealed that the 39-45 kDa IGFBP-3 fragment is a glycoprotein. (PMID: 23403918, PMID: 24926947, PMID: 19887447) Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0242 Product name: Recombinant human IGFBP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 134-291 aa of BC000013 Sequence: PGNASESEEDRSAGSVESPSVSSTHRVSDPKFHPLHSKIIIIKKGHAKDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGKEDVHCYSMQSK Predict reactive species Full Name: insulin-like growth factor binding protein 3 Calculated Molecular Weight: 32 kDa Observed Molecular Weight: 32 kDa, 40-45 kDa GenBank Accession Number: BC000013 Gene Symbol: IGFBP3 Gene ID (NCBI): 3486 RRID: AB_2123233 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P17936 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.