Proteintech, 10195-1-AP, RUVBL2 Polyclonal antibody

Size: 20ul / 150ul The RUVBL2 (10195-1-AP) by Proteintech is a Polyclonal antibody targeting RUVBL2 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 10195-1-AP targets RUVBL2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: C2C12 cells, Daudi cells, HeLa cells, HepG2 cells Positive IP detected in: HeLa cells, mouse brain tissue Positive IHC detected in: rat bladder tissue, human gliomas tissue, human placenta tissue, mouse bladder tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information RuvB-like 2 (E. coli) (RUVBL2, synonyms: ECP51, TIP48, CGI-46, TIP49B) is the second human homologue of the bacterial RuvB gene. Bacterial RuvB protein is a DNA helicase essential for homologous recombination and DNA double-strand break repair. Functional analysis showed that RUVBL2 has both ATPase and DNA helicase activities. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0253 Product name: Recombinant human RUVBL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 220-463 aa of BC000428 Sequence: SQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS Predict reactive species Full Name: RuvB-like 2 (E. coli) Calculated Molecular Weight: 51 kDa Observed Molecular Weight: 51 kDa GenBank Accession Number: BC000428 Gene Symbol: RUVBL2 Gene ID (NCBI): 10856 RRID: AB_2184679 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y230 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.