Iright
BRAND / VENDOR: Proteintech

Proteintech, 10200-1-AP, WTAP Polyclonal antibody

CATALOG NUMBER: 10200-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The WTAP (10200-1-AP) by Proteintech is a Polyclonal antibody targeting WTAP in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 10200-1-AP targets WTAP in WB, IHC, IF, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, HepG2 cells, MOLT-4 cells, L02 cells, K-562 cells Positive IP detected in: Jurkat cells, HEK-293 cells Positive IHC detected in: human intrahepatic cholangiocarcinoma tissue, human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information WTAP, also named as KIAA0105 and hFL(2)D, is previously identified as a protein associated with Wilms' tumor-1 (WT-1) protein that is essential for the development of the genitourinary system. It is a Pre-mRNA-splicing regulator protein. It is a regulatory subunit of the WMM N6-methyltransferase complex which plays a role in the efficiency of mRNA splicing and processing and mRNA stability. It is required for accumulation of METTL3 and METTL14 to nuclear speckle. MW of WTAP is 50-55 kDa due to phosphorylation. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0259 Product name: Recombinant human WTAP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-150 aa of BC000383 Sequence: TNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYTDLNSNDVTGLRESEEKLKQQQQESARRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGELEQTKDKLEQAQNELSAWKFTPD Predict reactive species Full Name: Wilms tumor 1 associated protein Calculated Molecular Weight: 45 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC000383 Gene Symbol: WTAP Gene ID (NCBI): 9589 RRID: AB_2216349 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15007 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924