Proteintech, 10232-1-AP, ARL2 Polyclonal antibody

Size: 20ul / 150ul The ARL2 (10232-1-AP) by Proteintech is a Polyclonal antibody targeting ARL2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 10232-1-AP targets ARL2 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, HeLa cells, mouse lung tissue, mouse spleen tissue, Y79 cells Positive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information The ADP-ribosylation factor (ARF) genes are small GTP-binding proteins of the RAS superfamily. ADP-ribosylation factor-like 2 (ARL2) is a member of a functionally distinct group of ARF-like genes. ARL2 interacts with the tubulin-specific chaperone protein known as cofactor D. ARL2 downregulates the tubulin GAP activity of cofactor C, D, and E, and inhibits the binding of D to native tubulin. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0334 Product name: Recombinant human ARL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-184 aa of BC002530 Sequence: GLLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSSNAIREVLELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRIFTAD Predict reactive species Full Name: ADP-ribosylation factor-like 2 Calculated Molecular Weight: 21 kDa Observed Molecular Weight: 21-25 kDa GenBank Accession Number: BC002530 Gene Symbol: ARL2 Gene ID (NCBI): 402 RRID: AB_2034885 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P36404 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.