Proteintech, 10237-1-AP, S100A11 Polyclonal antibody

Size: 20ul / 150ul The S100A11 (10237-1-AP) by Proteintech is a Polyclonal antibody targeting S100A11 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 10237-1-AP targets S100A11 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, Neutralization, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: DU 145 cells, HCT 116 cells, BxPC-3 cells, human lung tissue, HEK-293 cells, human heart tissue, COLO 320 cells, HaCaT cells, U2OS cells, SKOV-3 cells Positive IP detected in: DU 145 cells, PC-3 cells Positive IHC detected in: human breast cancer tissue, human cervical cancer tissue, human colon tissue, human colon cancer tissue, human liver cancer tissue, human lung cancer tissue, human ovary tumor tissue, human thyroid cancer tissue, mouse kidney tissue, rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: PC-3 cells, BxPC-3 cells Positive FC (Intra) detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension Background Information S100A11 (also known as S100C or calziggarin), is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs (PMID: 18694925). S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. First discovered in 1989, S100A11 has since been proposed to have direct biological functions in an assortment of physiological processes such as endo- and exocytosis, regulation of enzyme activity, cell growth and regulation, apoptosis and inflammation (PMID: 15241500). Chromosomal rearrangements and altered expression of S100A11 have been implicated in tumor metastasis. This S100A11 antibody (10237-1-AP) has also been instrumental in investigations into S100A11's role in the development of brain tumors in tuberous sclerosis complex (TSC) patients (PMID: 20133820). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0343 Product name: Recombinant human S100A11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 3-105 aa of BC001410 Sequence: KISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT Predict reactive species Full Name: S100 calcium binding protein A11 Calculated Molecular Weight: 105 aa, 12 kDa Observed Molecular Weight: 12 kDa GenBank Accession Number: BC001410 Gene Symbol: S100A11 Gene ID (NCBI): 6282 RRID: AB_2183478 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P31949 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.