Iright
BRAND / VENDOR: Proteintech

Proteintech, 10258-1-AP, Testin Polyclonal antibody

CATALOG NUMBER: 10258-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Testin (10258-1-AP) by Proteintech is a Polyclonal antibody targeting Testin in WB, IHC, IF/ICC, IF-P, IP, ELISA applications with reactivity to human, mouse samples 10258-1-AP targets Testin in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, K-562 cells, MCF-7 cells, mouse testis tissue Positive IP detected in: K-562 cells Positive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse heart tissue Positive IF/ICC detected in: A549 cells, HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Testin (TES) is a cytoskeleton-associated protein that localizes along actin stress fibers at cell-cell contact areas and at focal adhesion plaques. It interacts with a variety of cytoskeletal proteins and gets involved in regulation of cell adhesion and migration. TES is a putative tumor suppressor and reduced expression of TES has been reported in various cancers. In addition, TES is a marker for Sertoli-Germ Cell junction and is useful to monitor the disruption of intercellular junctions in the testis. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0379 Product name: Recombinant human TES protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 108-323 aa of BC001451 Sequence: TVTYEWAPPVQNQALARQYMQMLPKEKQPVAGSEGAQYRKKQLAKQLPAHDQDPSKCHELSPREVKEMEQFVKKYKSEALGVGDVKLPCEMDAQGPKQMNIPGGDRSTPAAVGAMEDKSAEHKRTQYSCYCCKLSMKEGDPAIYAERAGYDKLWHPACFVCSTCHELLVDMIYFWKNEKLYCGRHYCDSEKPRCAGCDELIFSNEYTQAENQNWHL Predict reactive species Full Name: testis derived transcript (3 LIM domains) Calculated Molecular Weight: 48 kDa Observed Molecular Weight: 38-48 kDa GenBank Accession Number: BC001451 Gene Symbol: TES Gene ID (NCBI): 26136 RRID: AB_2201712 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UGI8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924