Iright
BRAND / VENDOR: Proteintech

Proteintech, 10274-1-AP, TAU Polyclonal antibody

CATALOG NUMBER: 10274-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TAU (10274-1-AP) by Proteintech is a Polyclonal antibody targeting TAU in WB, IHC, IF-P, IF-Fro, ELISA applications with reactivity to human, mouse, rat samples 10274-1-AP targets TAU in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain Positive IHC detected in: human brain tissue, human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Positive IF-Fro detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500 Background Information Tau (tubulin-associated unit) is a microtubule-associated protein (also known as MAPT), expressed mainly in neurons of the central nervous system. Its primary function is to modulate microtubule dynamics for maintaining axonal cytoskeleton. Various isoforms of Tau exist due to the alternative splicing, and short isoforms around 45-69 kDa and long isoforms around 100-110 kDa have been reported in different literature (8752131,15965697). Present polyclonal anti-Tau antibody was produced by immunizing animals with N-terminal of Tau and can detect approx 45-70 kDa and 100-kDa bands in brain tissues. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, goat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0354 Product name: Recombinant human TAU protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 5-208 aa of BC000558 Sequence: PRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENL Predict reactive species Full Name: microtubule-associated protein tau Calculated Molecular Weight: 37-46, 79-81 kDa Observed Molecular Weight: 45-70 kDa, 100 kDa GenBank Accession Number: BC000558 Gene Symbol: TAU Gene ID (NCBI): 4137 RRID: AB_2139718 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P10636 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924