Iright
BRAND / VENDOR: Proteintech

Proteintech, 10308-1-AP, AMPK Beta 1 Polyclonal antibody

CATALOG NUMBER: 10308-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The AMPK Beta 1 (10308-1-AP) by Proteintech is a Polyclonal antibody targeting AMPK Beta 1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 10308-1-AP targets AMPK Beta 1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse liver tissue, A431 cells, HEK-293 cells, HeLa cells Positive IP detected in: mouse liver tissue Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information AMPK Beta 1 (5'-AMP-activated protein kinase subunit beta-1) is also named as PRKAB1 and AMPK. AMPK, a serine/threonine kinase that exists as a heterotrimer comprised of a catalytic α-subunit and regulatory β- and γ-subunits, has been recognized as a sensor of cellular energy homeostasis (PMID: 21937710). AMPK regulates key metabolic enzymes, cell growth, apoptosis, gene transcription, and protein synthesis (PMID: 12829246). AMPK is an energy sensor and plays an essential role in the control of cellular bioenergetics by responding to various stresses including those that induce changes in the cellular AMP:ATP ratio or modulation in intracellular calcium (PMID: 27812976, PMID: 26616193). Recent studies have shown that AMPK mediates the inhibition of cell proliferation and growth of tumor cells (PMID: 16613876). AMPK also inhibits the expression of Glut1 and glycolysis in Tregs by inhibiting mTORC1 signaling (PMID: 25477880). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0301 Product name: Recombinant human PRKAB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 62-269 aa of BC001007 Sequence: AWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKP Predict reactive species Full Name: protein kinase, AMP-activated, beta 1 non-catalytic subunit Calculated Molecular Weight: 38 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC001007 Gene Symbol: PRKAB1 Gene ID (NCBI): 5564 RRID: AB_513239 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y478 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924