Iright
BRAND / VENDOR: Proteintech

Proteintech, 10309-1-AP, GPRC5A,RAI3 Polyclonal antibody

CATALOG NUMBER: 10309-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GPRC5A,RAI3 (10309-1-AP) by Proteintech is a Polyclonal antibody targeting GPRC5A,RAI3 in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse samples 10309-1-AP targets GPRC5A,RAI3 in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A375 cells, MCF-7 cells, HeLa cells, RAW 264.7 cells Positive IHC detected in: human lung cancer tissue, human breast cancer tissue, human colon cancer tissue, human lung squamous cell carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:1000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information GPRC5A, also named as GPCR5A, RAI3 and RAIG1, belongs to the G-protein coupled receptor 3 family. It is an orphan G-protein coupled receptor (GPCR) that has been associated with malignancy and may play a role in the proliferation of breast cancer cells. GPRC5A is a potential molecular target for treatment of breast cancers. It is suppressed in some human lung carcinoma cells. (PMID:15788639, 20563252, 19552806 ) Specification Tested Reactivity: human, mouse Cited Reactivity: human, goat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0311 Product name: Recombinant human GPRC5A,RAI3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 106-330 aa of BC003665 Sequence: SICFSCLLAHAVSLTKLVRGRKPLSLLVILGLAVGFSLVQDVIAIEYIVLTMNRTNVNVFSELSAPRRNEDFVLLLTYVLFLMALTFLMSSFTFCGSFTGWKRHGAHIYLTMLLSIAIWVAWITLLMLPDFDRRWDDTILSSALAANGWVFLLAYVSPEFWLLTKQRNPMDYPVEDAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQP Predict reactive species Full Name: G protein-coupled receptor, family C, group 5, member A Calculated Molecular Weight: 40 kDa Observed Molecular Weight: 40-45 kDa GenBank Accession Number: BC003665 Gene Symbol: GPRC5A Gene ID (NCBI): 9052 RRID: AB_2877732 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NFJ5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924