Proteintech, 10312-1-AP, ARL4 Polyclonal antibody

Size: 20ul / 150ul The ARL4 (10312-1-AP) by Proteintech is a Polyclonal antibody targeting ARL4 in WB, ELISA applications with reactivity to human, mouse, rat samples 10312-1-AP targets ARL4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0342 Product name: Recombinant human ARL4A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 4-175 aa of BC001111 Sequence: GLSDQTSILSNLPSFQSFHIVILGLDCAGKTTVLYRLQFNEFVNTVPTKGFNTEKIKVTLGNSKTVTFHFWDVGGQEKLRPLWKSYTRCTDGIVFVVDSVDVERMEEAKTELHKITRISENQGVPVLIVANKQDLRNSLSLSEIEKLLAMGELSSSTPWHLQPTCAIIGDGL Predict reactive species Full Name: ADP-ribosylation factor-like 4A Calculated Molecular Weight: 23 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: BC001111 Gene Symbol: ARL4A Gene ID (NCBI): 10124 RRID: AB_2058646 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P40617 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.