Iright
BRAND / VENDOR: Proteintech

Proteintech, 10316-1-AP, WBP11 Polyclonal antibody

CATALOG NUMBER: 10316-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The WBP11 (10316-1-AP) by Proteintech is a Polyclonal antibody targeting WBP11 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 10316-1-AP targets WBP11 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse heart tissue Positive IP detected in: mouse heart tissue Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information WBP11 (WW domain-binding protein 11) is a protein that in humans, is encoded by the WBP11 gene. The function of WBP11 is to play a role in the regulation of pre-mRNA processing. More specifically, this nuclear protein, colocalizes with mRNA splicing factors and intermediate filament-containing perinuclear networks. The predicted MW of this protein is 70 kDa, and this antibody specially recognises the 70 kDa protein. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0366 Product name: Recombinant human WBP11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 170-379 aa of BC001621 Sequence: TSAYGPPTRAVSILPLLGHGVPRLPPGRKPPGPPPGPPPPQVVQMYGRKVGFALDLPPRRRDEDMLYSPELAQRGHDDDVSSTSEDDGYPEDMDQDKHDDSTDDSDTDKSDGESDGDEFVHRDNGERDNNEEKKSGLSVRFADMPGKSRKKKKNMKELTPLQAMMLRMAGQEIPEEGREVEEFSEDDDEDDSDDSEAEKQSQKQHKEESH Predict reactive species Full Name: WW domain binding protein 11 Calculated Molecular Weight: 70 kDa Observed Molecular Weight: 66-70 kDa GenBank Accession Number: BC001621 Gene Symbol: WBP11 Gene ID (NCBI): 51729 RRID: AB_10694664 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y2W2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924