Iright
BRAND / VENDOR: Proteintech

Proteintech, 10325-1-AP, TRAP1 Polyclonal antibody

CATALOG NUMBER: 10325-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TRAP1 (10325-1-AP) by Proteintech is a Polyclonal antibody targeting TRAP1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 10325-1-AP targets TRAP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HL-60 cells, HeLa cells, mouse heart tissue, Raji cells, HepG2 cells, K-562 cells, NIH/3T3 cells Positive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information TNF receptor-associated protein 1 (TRAP1, synonym: HSP75) is a member of the HSP90 family of molecular chaperones, and is expressed ubiquitously and located to mitochondria. A unique LxCxE motif in HSP75, but not in other HSP90 family members, appears to be important for binding to the simian virus 40 T-antigen-binding domain of hypophosphorylated Rb. Data also suggests that suppression of the expression of TRAP1 in mitochondria plays an important role in the induction of apoptosis caused via formation of reactive oxygen species (ROS). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0400 Product name: Recombinant human TRAP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 446-704 aa of BC000406 Sequence: MREGIVTATEQEVKEDIAKLLRYESSALPSGQLTSLSEYASRMRAGTRNIYYLCAPNRHLAEHSPYYEAMKKKDTEVLFCFEQFDELTLLHLREFDKKKLISVETDIVVDHYKEEKFEDRSPAAECLSEKETEELMAWMRNVLGSRVTNVKVTLRLDTHPAMVTVLEMGAARHFLRMQQLAKTQEERAQLLQPTLEINPRHALIKKLNQLRASEPGLAQLLVDQIYENAMIAAGLVDDPRAMVGRLNELLVKALERH Predict reactive species Full Name: TNF receptor-associated protein 1 Calculated Molecular Weight: 80 kDa Observed Molecular Weight: 66-70 kDa, 60 kDa GenBank Accession Number: BC000406 Gene Symbol: TRAP1 Gene ID (NCBI): 10131 RRID: AB_2303284 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q12931 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924