Proteintech, 10352-1-AP, SNRPD1 Polyclonal antibody

Size: 20ul / 150ul The SNRPD1 (10352-1-AP) by Proteintech is a Polyclonal antibody targeting SNRPD1 in WB, ELISA applications with reactivity to human samples 10352-1-AP targets SNRPD1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HL-60 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Systemic lupus erythematosus is characterized by antibodies to a variety of intracellular self-antigens, such as dsDNA and Sm, and these serve as hallmarks in the diagnosis of systemic autoimmune diseases. SNRPD1 is one Sm components of the small nuclear ribonucleoprotein complexes(snRNPs). It's a charged protein scaffold to promote snRNP assembly or strengthen snRNP-snRNP interactions through nonspecific electrostatic contacts with RNA. This antibody detectes 13-16 kDa (SMD1) and 30 kDa (SMD1/SMD2 dimer form; PMID:15525645). Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0364 Product name: Recombinant human SNRPD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-119 aa of BC001721 Sequence: MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR Predict reactive species Full Name: small nuclear ribonucleoprotein D1 polypeptide 16kDa Calculated Molecular Weight: 16 kDa Observed Molecular Weight: 13 kDa GenBank Accession Number: BC001721 Gene Symbol: SNRPD1 Gene ID (NCBI): 6632 RRID: AB_2193875 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P62314 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.