Iright
BRAND / VENDOR: Proteintech

Proteintech, 10359-1-AP, HBS1L Polyclonal antibody

CATALOG NUMBER: 10359-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HBS1L (10359-1-AP) by Proteintech is a Polyclonal antibody targeting HBS1L in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 10359-1-AP targets HBS1L in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, A2780 cells, HEK-293 cells, mouse brain tissue, SKOV-3 cells Positive IP detected in: mouse brain tissue Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information HBS1L (HBS1-like), also known as EF-1a or ERFS, is a 684 amino acid protein that belongs to the GTP-binding elongation factor family and exists as multiple alternatively spliced isoforms. Expressed in kidney, brain, heart, placenta, liver, muscle and pancreas, HSB1L is thought to play a role in controlling fetal hemoglobin levels, specifically influencing platelet, monocyte and erythrocyte hemoglobin content. The gene encoding HBS1L maps to a locus on human chromosome 6 that is associated with sickle cell anemia and beta-thalassemia, suggesting a role for HBS1L in the pathogenesis of blood disorders.This antibody specifically recognizes the 75kd human HBS1L protein. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0388 Product name: Recombinant human HBS1L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 43-262 aa of BC001465 Sequence: SRRDKPSVEPVEEYDYEDLKESSNSVSNHQLSGFDQARLYSCLDHMREVLGDAVPDEILIEAVLKNKFDVQKALSGVLEQDRVQSLKDKNEATVSTGKIAKGKPVDSQTSRSESEIVPKVAKMTVSGKKQTMGFEVPGVSSEENGHSFHTPQKGPPIEDAIASSDVLETASKSANPPHTIQASEEQSSTPAPVKKSGKLRQQIDVKAELEKRQGGKQLLN Predict reactive species Full Name: HBS1-like (S. cerevisiae) Calculated Molecular Weight: 75 kDa Observed Molecular Weight: 75 kDa GenBank Accession Number: BC001465 Gene Symbol: HBS1L Gene ID (NCBI): 10767 RRID: AB_2114730 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y450 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924