Proteintech, 10373-2-AP, MMP2 Polyclonal antibody

Size: 20ul / 150ul The MMP2 (10373-2-AP) by Proteintech is a Polyclonal antibody targeting MMP2 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications with reactivity to human, mouse samples 10373-2-AP targets MMP2 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HT-1080 cells, MCF-7 cells, U-87 MG cells, HepG2 cells, U-251 cells, J774A.1 cells Positive IP detected in: MCF-7 cells Positive IHC detected in: human gliomas tissue, human placenta tissue, human prostate cancer tissue, human heart tissue, human oesophagus tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human placenta tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:100-1:400 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information MMP2, also named as CLG4A, Gelatinase Am, TBE-1 and PEX, belongs to the peptidase M10A family. It is ubiquitinous metalloproteinase that is involved in diverse functions such as remodeling of the vasculature, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. MMP2 contributes to myocardial oxidative stress by regulating the activity of GSK3beta. It cleaves GSK3beta in vitro. MMP2 can be cleaved into PEX chain(~60kd). Western blot analysis showed that the 72 kDa and 62/65 kDa proteinase activities were pro-MMP2 and the active enzyme, respectively (PMID:11112697,PMID: 30867536). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, pig, rabbit, monkey, bovine, fish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0549 Product name: Recombinant human MMP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 461-660 aa of BC002576 Sequence: LGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC Predict reactive species Full Name: matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase) Calculated Molecular Weight: 72 kDa Observed Molecular Weight: 62-72 kDa GenBank Accession Number: BC002576 Gene Symbol: MMP2 Gene ID (NCBI): 4313 RRID: AB_2250823 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P08253 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.