Product Description
Size: 20ul / 150ul
The MMP-9 (N-terminal) (10375-2-AP) by Proteintech is a Polyclonal antibody targeting MMP-9 (N-terminal) in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples
10375-2-AP targets MMP-9 (N-terminal) in WB, IHC, IF/ICC, FC (Intra), CoIP, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: Jurkat cells, HEK-293 cells, LNCaP cells, U2OS cells, HepG2 cells, Raji cells, MDA-MB-231 cells
Positive IHC detected in: human breast cancer tissue, human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: HepG2 cells
Positive FC (Intra) detected in: HeLa cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:3000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
Background Information
Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, tissue remodeling, and disease processes, such as arthritis or metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. Matrix metalloproteinase 9 (gelatinase B, 92 kDa gelatinase, 92 kDa type IV collagenase) (MMP9, synonyms: GELB, CLG4B) degrades collagens type IV and V. Studies in rhesus monkeys suggest that MMP9 is involved in IL-8-induced mobilization hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling. The pro-MMP9 is 92 kDa, and it can be detected a processed form of 68 kDa. This protein can exist as a dimer of 180 kDa (PMID:7492685).
Specification
Tested Reactivity: human
Cited Reactivity: human, mouse, rat, pig, rabbit, bovine, hamster, fish
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag0552 Product name: Recombinant human MMP9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC006093 Sequence: MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCG Predict reactive species
Full Name: matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase)
Calculated Molecular Weight: 707 aa, 78 kDa
Observed Molecular Weight: 92 kDa, 67 kDa
GenBank Accession Number: BC006093
Gene Symbol: MMP-9
Gene ID (NCBI): 4318
RRID: AB_10897178
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P14780
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924