Proteintech, 10386-1-AP, KRBP Polyclonal antibody

Size: 20ul / 150ul The KRBP (10386-1-AP) by Proteintech is a Polyclonal antibody targeting KRBP in WB, ELISA applications with reactivity to human, mouse samples 10386-1-AP targets KRBP in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information ZNF426 is a 554 amino acid protein, which contains one KRAB domain and twelve C2H2-type zinc fingers. ZNF426 localizes in the nucleus and may be involved in transcriptional regulation. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0585 Product name: Recombinant human KRBP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 141-380 aa of BC001791 Sequence: NGRELCDCEQCGEVFSEHSCLKTHVRTQSTGNTHDCNQYGKDFLTLCEKTSTGEKLSEFNQSEKIFSLTPNIVYQRTSTQEKSFECSHCGKSFINESYLQAHMRTHNGEKLYEWRNYGPGFIDSTSLSVLIETLNAKKPYKCKECGKGYRYPAYLSIHMRTHTGEKPYECKECGKAFNYSNSFQIHGRTHTGEKPYVCKECGKAFTQYSGLSMHVRSHSGDKPYECKECGKSFLTSSRLI Predict reactive species Full Name: zinc finger protein 426 Calculated Molecular Weight: 63 kDa Observed Molecular Weight: 63 kDa GenBank Accession Number: BC001791 Gene Symbol: ZNF426 Gene ID (NCBI): 79088 RRID: AB_2242273 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BUY5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.