Iright
BRAND / VENDOR: Proteintech

Proteintech, 10402-1-AP, BCAS3 Polyclonal antibody

CATALOG NUMBER: 10402-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The BCAS3 (10402-1-AP) by Proteintech is a Polyclonal antibody targeting BCAS3 in WB, ELISA applications with reactivity to human, mouse, rat samples 10402-1-AP targets BCAS3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, A431 cells, HeLa cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Rudhira/BCAS3 (Breast Cancer Amplified Sequence 3) is a conserved protein expressed in the embryonic vasculature and malignant tumors. Rudhira is a predicted WD40 domain protein. During mouse development Rudhira is expressed in erythropoietic and angiogenic precursors but not in their differentiated progeny. This transient expression of Rudhira is also seen in normal adult angiogenesis. BCAS3, the human ortholog of Rudhira is 98% identical and the gene maps to a breakpoint of hematological neoplasms on chromosome 17q23.1. BCAS3 is also expressed in vascular development in embryoid bodies in vitro and was originally identified as a gene over-expressed in breast cancers. It is reported to be a target of metastasis associated protein-1 (MTA-1). Further BCAS3 expression is also upregulated in grade III and IV glioblastomas where it is misexpressed in the tumor cells. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0646 Product name: Recombinant human BCAS3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 653-928 aa of BC001250 Sequence: SWTLVRTPQWNELQPPFNANHPLLLAADAVQYYQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASGTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSRDVVGSGTELQREGSIETLSNSSGSTSGSIPRNFDGYRSPLPTNESQPLSLFPTGFP Predict reactive species Full Name: breast carcinoma amplified sequence 3 Calculated Molecular Weight: 99 kDa Observed Molecular Weight: 74 kDa GenBank Accession Number: BC001250 Gene Symbol: BCAS3 Gene ID (NCBI): 54828 RRID: AB_10897181 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H6U6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924