Iright
BRAND / VENDOR: Proteintech

Proteintech, 10428-1-AP, MFI2 Polyclonal antibody

CATALOG NUMBER: 10428-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MFI2 (10428-1-AP) by Proteintech is a Polyclonal antibody targeting MFI2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 10428-1-AP targets MFI2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, Transfected Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information MFI2 (Melanotransferrin/Mtf/TRMF), also known as p97 or CD228, is an iron-binding glycoprotein belonging to the transferrin family. Alternative RNA splicing yields two forms of different length transcripts, one (the longer) bound to the membrane (mMFI2) and the other (the shorter) secreted to the peripheral environment (sMFI2) such as blood and cell supernatant. MFI2 is upregulated in tumor tissues and has been identified as a serological marker of colorectal cancer (PMID: 25216327). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0700 Product name: Recombinant human MFI2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 118-302 aa of BC001875 Sequence: HVTIDTLKGVKSCHTGINRTVGWNVPVGYLVESGRLSVMGCDVLKAVSDYFGGSCVPGAGETSYSESLCRLCRGDSSGEGVCDKSPLERYYDYSGAFRCLAEGAGDVAFVKHSTVLENTDESPSRRQTWTRSEEEEGECPAHEEARRTMRSSAGQAWKWAPVHRPQDESDKGEFGKRAKSRDMLG Predict reactive species Full Name: antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5 Calculated Molecular Weight: 80 kDa Observed Molecular Weight: 82 kDa GenBank Accession Number: BC001875 Gene Symbol: MFI2 Gene ID (NCBI): 4241 RRID: AB_2142592 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P08582 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924