Iright
BRAND / VENDOR: Proteintech

Proteintech, 10439-1-AP, EIF3J Polyclonal antibody

CATALOG NUMBER: 10439-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul EIF3J Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA 10439-1-AP targets EIF3J in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells, HEK-293 cells, Jurkat cells, K-562 cells, MCF-7 cells, SKOV-3 cells Positive IP detected in: HeLa cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information EIF3 has a key role in binding of initiator methionyl-tRNA and mRNA to the 40S ribosomal subunit to form the 40S initiation complex(PMID:17588516). The eIF3 complex stimulates several steps in the translation initiation pathway, including dissociation of 80S ribosomes into 40S and 60S subunits, binding of a ternary complex (TC) consisting of Met-tRNA , eIF2, and GTP to the small subunit (forming the 43S preinitiation complex) and recruitment of mRNA to the 43 S complex to produce the 48S complex (PMID:11560931) EIF3J was identified as a high copy suppressor of the temperature-sensitive (Ts-) phenotype of the rpg1-1 allele of TIF32/RPG1, encoding the largest subunit of yeast eIF3 (eIF3a) (PMID:10488093). Specification Tested Reactivity: human Cited Reactivity: human, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0678 Product name: Recombinant human EIF3J protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-258 aa of BC002719 Sequence: MAAAAAAAGDSDSWDADAFSVEDPVRKVGGGGTAGGDRWEGEDEDEDVKDNWDDDDDEKKEEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEEPKVLTPEEQLADKLRLKKLQEESDLELAKETFGVNNAVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEVLVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYDGGYVQDYEDFM Predict reactive species Full Name: eukaryotic translation initiation factor 3, subunit J Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC002719 Gene Symbol: EIF3J Gene ID (NCBI): 8669 RRID: AB_2097082 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75822 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924