Proteintech, 10445-1-AP, Histone H2A type 3 Polyclonal antibody

Size: 20ul / 150ul The Histone H2A type 3 (10445-1-AP) by Proteintech is a Polyclonal antibody targeting Histone H2A type 3 in WB, ELISA applications with reactivity to human, mouse, rat samples 10445-1-AP targets Histone H2A type 3 in WB, IP, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human brain tissue, fetal human brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Histone H2A type 3, it is expected to be located in the nucleus, and the protein is enriched in the brain tissue. Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H2A family. The molecular weight of Histone H2A type 3 is 14 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0374 Product name: Recombinant human HIST3H2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-130 aa of BC001193 Sequence: MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK Predict reactive species Full Name: histone cluster 3, H2a Calculated Molecular Weight: 14 kDa Observed Molecular Weight: 14-18 kDa GenBank Accession Number: BC001193 Gene Symbol: Histone H2A type 3 Gene ID (NCBI): 92815 RRID: AB_2116701 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7L7L0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.