Iright
BRAND / VENDOR: Proteintech

Proteintech, 10456-1-AP, NELF-A Polyclonal antibody

CATALOG NUMBER: 10456-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NELF-A (10456-1-AP) by Proteintech is a Polyclonal antibody targeting NELF-A in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 10456-1-AP targets NELF-A in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, mouse liver tissue, Jurkat cells, mouse brain tissue Positive IP detected in: mouse brain tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:300-1:1200 Background Information WHSC2, also known as NELF-A, is a component of the Negative ELongation Factor complex, which inhibits RNA polymerase II progression early during elongation (a process referred to as 'promoter proximal pausing'), thereby altering expression of its target genes in a positive and negative manner [PMID:19245807]. This complex acts with DRB sensitivity-inducing factor (DSIF), a heterodimer of SPT4 and SPT5, to cause transcriptional pausing of RNA polymerase II[PMID:12612062]. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0708 Product name: Recombinant human NELF-A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 6-314 aa of BC002764 Sequence: ESDTGLWLHNKLGATDELWAPPSIASLLTAAVIDNIRLCFHGLSSAVKLKLLLGTLHLPRRTVDEMKGALMEIIQLASLDSDPWVLMVADILKSFPDTGSLNLELEEQNPNVQDILGELREKVGECEASAMLPLECQYLNKNALTTLAGPLTPPVKHFQLKRKPKSATLRAELLQKSTETAQQLKRSAGVPFHAKGRGLLRKMDTTTPLKGIPKQAPFRSPTAPSVFSPTGNRTPIPPSRTLLRKERGVKLLDISELDMVGAGREAKRRRKTLDAEVVEKPAKEETVVENATPDYAAGLVSTQKLGSLN Predict reactive species Full Name: Wolf-Hirschhorn syndrome candidate 2 Calculated Molecular Weight: 57 kDa Observed Molecular Weight: 57 kDa GenBank Accession Number: BC002764 Gene Symbol: NELFA Gene ID (NCBI): 7469 RRID: AB_2216327 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H3P2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924