Proteintech, 10461-1-AP, SYNGR2 Polyclonal antibody

Size: 20ul / 150ul The SYNGR2 (10461-1-AP) by Proteintech is a Polyclonal antibody targeting SYNGR2 in WB, ELISA applications with reactivity to human, mouse, rat samples 10461-1-AP targets SYNGR2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, mouse kidney tissue, mouse lung tissue, mouse skeletal muscle tissue, rat lung tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0720 Product name: Recombinant human SYNGR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 81-224 aa of BC000407 Sequence: ASAFFLVVDAYFPQISNATDRKYLVIGDLLFSALWTFLWFVGFCFLTNQWAVTNPKDVLVGADSVRAAITFSFFSIFSWGVLASLAYQRYKAGVDDFIQNYVDPTPDPNTAYASYPGASVDNYQQPPFTQNAETTEGYQPPPVY Predict reactive species Full Name: synaptogyrin 2 Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 25-27 kDa GenBank Accession Number: BC000407 Gene Symbol: SYNGR2 Gene ID (NCBI): 9144 RRID: AB_3669121 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43760 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.