Iright
BRAND / VENDOR: Proteintech

Proteintech, 10463-1-AP, EIF4A3 Polyclonal antibody

CATALOG NUMBER: 10463-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The EIF4A3 (10463-1-AP) by Proteintech is a Polyclonal antibody targeting EIF4A3 in WB, IP, ELISA applications with reactivity to human, mouse samples 10463-1-AP targets EIF4A3 in WB, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, human lung tissue, mouse liver tissue, Raji cells Positive IP detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information EIF4A3 is a component of the exon junction complex (EJC), which assembles near exon-exon junctions of mRNAs as a result of splicing. EJC proteins involves in postsplicing events, including mRNA export, cytoplasmic localization, and nonsense-mediated decay. Its RNA-dependent ATPase and RNA-helicase activities are induced by CASC3, but abolished in presence of the MAGOH/RBM8A heterodimer, thereby trapping the ATP-bound EJC core onto spliced mRNA in a stable conformation. Besides, it involved in translational enhancement of spliced mRNAs after formation of the 80S ribosome complex and binds spliced mRNA in sequence-independent manner, 20-24 nucleotides upstream of mRNA exon-exon junctions Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0733 Product name: Recombinant human EIF4A3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC004386 Sequence: MATTATMATSGSARKRLLKEEDMTKVEFETSEEVDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCL Predict reactive species Full Name: eukaryotic translation initiation factor 4A, isoform 3 Calculated Molecular Weight: 47 kDa Observed Molecular Weight: 47 kDa GenBank Accession Number: BC004386 Gene Symbol: EIF4A3 Gene ID (NCBI): 9775 RRID: AB_2097394 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P38919 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924