Iright
BRAND / VENDOR: Proteintech

Proteintech, 10465-1-AP, LAMA4 (Isoform 3) Polyclonal antibody

CATALOG NUMBER: 10465-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The LAMA4 (Isoform 3) (10465-1-AP) by Proteintech is a Polyclonal antibody targeting LAMA4 (Isoform 3) in WB, IHC, ELISA applications with reactivity to human samples 10465-1-AP targets LAMA4 (Isoform 3) in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human heart tissue, human skeletal muscle tissue Positive IHC detected in: human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Laminin is a basement membrane glycoprotein composed of three nonidentical chains, A, B1, and B2 (PMID: 7959779). LAMA4 (laminin, alpha 4), an A chain variant, is a subunit of laminin-8 (laminin-411), laminin-9 (laminin-421) and laminin-14 (laminin-423) (PMID: 10842354; 10964957). LAMA4 is widely distributed in developing and adult human tissues, and mainly localized to mesenchyme-derived tissues (PMID: 12133914). It may have a role in formation and function of endothelium, transmigration of inflammatory cells through endothelium, and invasion of certain tumors (PMID: 17533363). Three alternatively spliced mRNAs give rise to three isoforms. This antibody was generated against the full length (1-120aa) of isoform 3. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0736 Product name: Recombinant human LAMA4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-120 aa of BC004241 Sequence: MALSSAWRSVLPLWLLWSAACSRAASGDDNAFPFDIEGSSAVGRQDPPETSEPRVALGRLPPAAEVQCPCHCHPAGAPAPPRAVPHSSFSLSPPLSSPQCLESFTWARSVRKLEIKSFPL Predict reactive species Full Name: laminin, alpha 4 Calculated Molecular Weight: 13 kDa Observed Molecular Weight: 11-13 kDa GenBank Accession Number: BC004241 Gene Symbol: Laminin alpha 4/LAMA4 Gene ID (NCBI): 3910 RRID: AB_2234461 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16363 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924