Iright
BRAND / VENDOR: Proteintech

Proteintech, 10480-1-AP, Prothymosin Alpha Polyclonal antibody

CATALOG NUMBER: 10480-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Prothymosin Alpha (10480-1-AP) by Proteintech is a Polyclonal antibody targeting Prothymosin Alpha in IHC, ELISA applications with reactivity to human, rat samples 10480-1-AP targets Prothymosin Alpha in IHC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive IHC detected in: human thyroid cancer tissue, human lymphoma tissue, rat colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:100-1:500 Background Information Prothymosin alpha (PTMA) is a nuclear protein possessing a number of cellular functions including cell survival. PTMA is identified to be localized in the nuclei of neurons, while it is found in both nuclei and cytoplasm in the astrocytes and microglia of adult brai. PTMA inhibits the neuronal necrosis induced by serum-free starvation or ischemia-reperfusion stress, which causes a rapid internalization of GLUT1/4, leading a decrease in glucose uptake and cellular ATP levels. Extensive research on PTMA showed that it is of clinical significance and potential medical use as they may serve as a molecular marker for cancer prognosis and/or as therapeutic agents for treating immunodeficiencies, autoimmune diseases and malignancies. Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0732 Product name: Recombinant human PTMA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-110 aa of BC003510 Sequence: MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNANEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAESATGKRAAEDDEDDDVDTKKQKTDEDD Predict reactive species Full Name: prothymosin, alpha Calculated Molecular Weight: 12 kDa GenBank Accession Number: BC003510 Gene Symbol: Prothymosin Alpha/PTMA Gene ID (NCBI): 5757 RRID: AB_2174388 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P06454 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924