Iright
BRAND / VENDOR: Proteintech

Proteintech, 10482-1-AP, SF3B4 Polyclonal antibody

CATALOG NUMBER: 10482-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SF3B4 (10482-1-AP) by Proteintech is a Polyclonal antibody targeting SF3B4 in WB, IP, IHC, ELISA applications with reactivity to human samples 10482-1-AP targets SF3B4 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells, HEK-293 cells, PC-3 cells Positive IP detected in: HeLa cells Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information SF3B4, also named as Pre-mRNA-splicing factor SF3b 49 kDa subunit, is a 424 amino acid protein, which belongs to the SF3B4 family. SF3B4 is a subunit of the splicing factor SF3B required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. SF3B4 has been found in complex 'B' and 'C' as well. Belongs also to the minor U12-dependent spliceosome, which is involved in the splicing of rare class of nuclear pre-mRNA intron. The calculated molecular weight of SF3B4 is 44 kDa. Based on its predicted molecular mass and the observed migration of the 50kDa cross-linked species on two-dimensional gels.(PMID: 9614130) Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0737 Product name: Recombinant human SF3B4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of BC004273 Sequence: MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNP Predict reactive species Full Name: splicing factor 3b, subunit 4, 49kDa Calculated Molecular Weight: 44 aa, 3 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC004273 Gene Symbol: SF3B4 Gene ID (NCBI): 10262 RRID: AB_2301639 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15427 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924